Description
Gene Model Namearadu.Aradu.S0IB0
Micro Synteny Viewaradu.Aradu.S0IB0
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_01KHS4
Descriptionputative ribonuclease H protein At1g65750-like [Glycine max]; IPR012337 (Ribonuclease H-like domain); GO:0003676 (nucleic acid binding)
Protein domainsG3DSA:3.30.420.10 PF13456 SSF53098
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.S0IB0.1

Sequences
Gene Model Namearadu.Aradu.S0IB0
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.S0IB0.1 sequence

>aradu.Aradu.S0IB0.1
TTTTTACTGTATGGCAAGTCTTCTTTCTTGTTCATCTCTTCCTTCTCCAC
GGCAGGGCTTCACTAAGCTGAATGTGAATGGTTGGCTATCTGACACTGAT
CACAGAGCTGGGTTTGGTTGTCATCTTACAGATGATTGTGGCGGTTGGTT
GGTTGGAATTTCTGGTTTTTTGGGGAACACTTCAATTCTATATGCTGAGT
TGTTTGCTGTCGAAAGAGGCCTCCTTCTCGCCTGGGATTGGGGGATCCGT
AAGCTTCTTTGTCATTCGGATTCTTTAATGGCTGTGACTTTGGTGTCCGA
TCATCTTGACTATCACCATCAATATGCTGGATTGATGGCTGATATCCAAA
ATTTGTTAGGCCGAGATTGGGAGGTGCAACTTCAGCACACTCTAAGAGGA
ATGAACTCTTGTGCTGATTTGTTGGCCAAGAAAGGGGCTAGGGATGACGA
TGCACTCAAGGTCTGGCTTCTACCTCCACTACCAATGAAGTGCTTGATGA
TAAATGATTCCATGGATGTTCCTTGTGATTATGATTATACAGGGACAAAT
AATGCTGTTTCTAGTAGCACTTCATCAAGCACCGAGCCTCTCGATGAAGA
TACAAAGAACCTAGATTATGACAGTGATGCCAAGAATTCTAAAATGCAGA
TGGCAAGTATTCATTTGGGTTCATCATCGCCTTCTCGGCATGAGCCAGGT
ACTGTTAATTGGGAGTTTACACCAGAGGGGTTCACAAAGCTGAATGTGGA
AGGTAGCTTATGTGAAAGTCATGACCGGGCGGGCTTTGGCTGTCTGCTTA
AGGATGATTGTGGTGCTTGGATTGTGGGTATTTCTGGTTTTCTTGGGAAT
GTTTCCATTCTATATGCTGAGTTGATTGCTTTGAAAAGGGGCCTCATTCT
AGCTTGGGATTGGGGCATCCGTATGCTTCTTTGTCATTCGGATTCTTTAA
TGGTGGTGTCTTTGGTATCTGGTGATCTTGACTATCATCATGAATATGCT
GGATTGGTGGCTGATATCCAAAATCTACTTGAGCGAGATTGGGAGGTGCA
TGTTGAGCGCACACCTAGTAAAGGGGTATCTTCTGCTGATTGGTTAGCTA
AGCAAGGGGCTAACGATGTTGATGCTCTAAAGATATGGCTTTTACCTCCA
CTACCAATGAACTTCTCTCTGATGGGCGAAGATTCCATGGATGTTCCTTG
TGTTTATGATTTTACTGGGAAATATGAAGCTGGCACTTCATTGATCATCA
GTTCGACCGATGAAGATACAGAGAATCCAGATTATGATCTTGAACTGATT
GAAGCCAAGAATGCTATAATGCAAGCAAGGATGGAGGAGGAACTCATTCA
GGCTCAGCTTGCTCAAGATGAACCAAGGATAGTCTGTTGGGTGTGTCCGC
CACAGGGGTTCGCAAAGCTGAACGTGGATGGTAGCTTTTATGAAAAACAG
CAAAAGGCAGGCTTTGGCTGTTTGCTGAGGGATGATTGTGGTACTTGGGT
GGTTGGCATCTCCGGCTTCCTTGAAAACAGTTCCACTCTGCATGCCGAGT
TGGCTGCTGTCGAAAGAGGCCTCCTTCTAGCCTGGGATTGGGGCATCCGA
AAGCTTATATGTCATTCAGACTCTATGACCGTTGTGAGCTTGGTCTCGAA
TGGCGGCAACCATGATCGCCATCAATTTGCTGGATTGTTGGCTAATATCC
AAGAACTGTTGCAGCGAGACTGGCAGGTTCAGGTTGAGCATACTTTGAGA
GAAGGGAACTCTTGTGCTGATTGGTTAGCGAAGGACGGGGCTAAAGACGA
TGTTGTGCTCAAGGTCTGGCTGCTAGCTCCACCGTCAATGGGTGACTTAC
TGATGGATGATTTCATGGGAGTCCCCTCTCTTAGACCTTCAAACCAGAAG
ACAGTTAGCAAGTTGGAGAGAGCCGTTCGCGCCAGATTGCGCGGCAAGAG
ATGAATTATACATATCACTATCACATGGTTGATGGTTCCACAAGTAAATT
GTAAATTGTATGTAAATATGTAAATTACCTTCCATATTTTCACAGTTGGG
AGTGTTTGCATCCTGGGTATGCTGTGTGTCTGTGCATGCCTCGGTAACTT
GGAAAAGGGGTTTTCCCCCTTTTATTCTTTAAAATAAAAGTTGTTTATTG
GGAGA
back to top
Protein Sequence

aradu.Aradu.S0IB0.1 sequence

>aradu.Aradu.S0IB0.1
MASLLSCSSLPSPRQGFTKLNVNGWLSDTDHRAGFGCHLTDDCGGWLVGI
SGFLGNTSILYAELFAVERGLLLAWDWGIRKLLCHSDSLMAVTLVSDHLD
YHHQYAGLMADIQNLLGRDWEVQLQHTLRGMNSCADLLAKKGARDDDALK
VWLLPPLPMKCLMINDSMDVPCDYDYTGTNNAVSSSTSSSTEPLDEDTKN
LDYDSDAKNSKMQMASIHLGSSSPSRHEPGTVNWEFTPEGFTKLNVEGSL
CESHDRAGFGCLLKDDCGAWIVGISGFLGNVSILYAELIALKRGLILAWD
WGIRMLLCHSDSLMVVSLVSGDLDYHHEYAGLVADIQNLLERDWEVHVER
TPSKGVSSADWLAKQGANDVDALKIWLLPPLPMNFSLMGEDSMDVPCVYD
FTGKYEAGTSLIISSTDEDTENPDYDLELIEAKNAIMQARMEEELIQAQL
AQDEPRIVCWVCPPQGFAKLNVDGSFYEKQQKAGFGCLLRDDCGTWVVGI
SGFLENSSTLHAELAAVERGLLLAWDWGIRKLICHSDSMTVVSLVSNGGN
HDRHQFAGLLANIQELLQRDWQVQVEHTLREGNSCADWLAKDGAKDDVVL
KVWLLAPPSMGDLLMDDFMGVPSLRPSNQKTVSKLERAVRARLRGKR.
back to top
Expression

Gene expression for aradu.Aradu.S0IB0 has been determined by its associated transcript, Adur12403_comp1_c0_seq1 in the transcript assemblies from Clevenger et al. 2016. Visualization of expression is provided by the eFP browser (Winter et al. 2007). Click the image to explore gene expression data for peanut.