Description
Gene Model Namearadu.Aradu.S11BY
Micro Synteny Viewaradu.Aradu.S11BY
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_TZGS5Z
Descriptionvillin-4-like isoform X8 [Glycine max]; IPR004263 (Exostosin-like)
Protein domainsPTHR11062 PTHR11062:SF11
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.S11BY.1

Sequences
Gene Model Namearadu.Aradu.S11BY
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.S11BY.1 sequence

>aradu.Aradu.S11BY.1
TCAATCGTTCTTCGTCTTCTCCAATTTCTATAATCATTCGTGCGCCTTTT
GAAGCAAAGCAAAACATGTAAAAAAAATTAAAAAATCAATCTGTTTTTCA
TATTTTTCAATTCTCCTAATATCATTAGTGCCCCTCCCGTCTCCTCTGAA
ACACGCCAAAACGGCAAAACCCTAGCCCTAGGTTCTTTGCCGCCGGCGTC
CCCGGACTCAGCGCTTCCGCTTCTTCCTCTTCCCTCTATCCGGAACCCAG
GTAGTTCGGCACATCGTCCCATCCTCGCTAGCTTCTCTGTCCGTGGCTTG
GAGCAGCTTGCCATCGGGTCACCGCTTGCCGTCGTCTCTGCTCTCGCCGT
CGTGTCGCCGGTTGCCGCCGTGTCTCTGTCGAAGATCTCTGTAGTGAAGC
TAGTGGATCCTGAAGTGAAGGAACGCAACAATGAGGAAGAAGGAGGTGAA
GAGTTGTCTGATATATACCACTCACCGCAGGTTTTCAAGCTGAACTATGC
GGAGATGATGGAGAAGTTCAAGGTTTGTATATATGCTGATGGAGATCCCA
AGACATTTTATCAAACACCTAGGAAGCTCACTGAGAAATACGCCAGCGGT
GAGGGATATTTCTTCCAAAAAATTCGGGAGAGCAGGTTTCGAACCCTCGA
TCCTGATCAGGCACACCTCTTCTTCATACCAATCTCCTGTCATAAGATGC
GTGGCGAGGTAAATATTTTCACACCGTTCTTCACTTGTTTCTTCAAATGG
GAGGCTGCAAAAGCTGCAATGCTTGGAAATTCATTTCAAAGGAAGCCTAC
AATCTTGAGAAATGGGGGTACTCCACCAGTGGTTGGGCGGTCGCCAGCAT
TTAACGCCATAGCATCCACTTTTGAGAAGCCTAAAGATAGGAACCTTTCA
ACCCCACCTCCAATTGTGAGAAAAGTGTATCCAAAATCAGGGACAGCAAA
CTTGAATACTCTTTCTCTTGGTCTTGGATCTAAGTCTTCAGCCATAGCTC
GGCTTACTTCTAGTTTTGAAATGCCTTCAGCACGGGGAAAGTTGATACCT
CAGTCGCTTAGAGTGACTTCCAATACACTCAAATCAAACCCAAAAAGAAG
TGATAGTGAGGATTCTATGAGCAGCGGATTAGAATCTCTTACAGAGGAAG
ATGCAAAAGAAGGTGAAGCTGACGATGATGAAGGACTCCCAGTTTATCCG
TATGGTAGCGTTAACACAGCTTCTAGCAATCCAGTACCAGACAACGAGAG
ATATGCTATCTATTCTGTAGTGATAAACTGGCATGGATTGAAAGGGACAG
CATCAGTGTTTTTTAACATAGCTGCTTCTGCTCCTCCCAAGATGGATTTC
ATGATGTAG
back to top
Protein Sequence

aradu.Aradu.S11BY.1 sequence

>aradu.Aradu.S11BY.1
SAPPVSSETRQNGKTLALGSLPPASPDSALPLLPLPSIRNPGSSAHRPIL
ASFSVRGLEQLAIGSPLAVVSALAVVSPVAAVSLSKISVVKLVDPEVKER
NNEEEGGEELSDIYHSPQVFKLNYAEMMEKFKVCIYADGDPKTFYQTPRK
LTEKYASGEGYFFQKIRESRFRTLDPDQAHLFFIPISCHKMRGEVNIFTP
FFTCFFKWEAAKAAMLGNSFQRKPTILRNGGTPPVVGRSPAFNAIASTFE
KPKDRNLSTPPPIVRKVYPKSGTANLNTLSLGLGSKSSAIARLTSSFEMP
SARGKLIPQSLRVTSNTLKSNPKRSDSEDSMSSGLESLTEEDAKEGEADD
DEGLPVYPYGSVNTASSNPVPDNERYAIYSVVINWHGLKGTASVFFNIAA
SAPPKMDFMM.
back to top