Description
Gene Model Namearadu.Aradu.TSK3V
Micro Synteny Viewaradu.Aradu.TSK3V
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Family not assigned to a gene family
Descriptiontrehalase; IPR001661 (Glycoside hydrolase, family 37); GO:0005991 (trehalose metabolic process)
Protein domainsPF01204
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.TSK3V.1

Sequences
Gene Model Namearadu.Aradu.TSK3V
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.TSK3V.1 sequence

>aradu.Aradu.TSK3V.1
GTTCACCCTCTTCGAGACACACCAAGCATTCCAAAATCTTCCAAGATTGA
GTTCCAATGGGGCGATTTCTGTGTAGGTGCTGATACTTTGAAGGCGCATG
GGATGATTTGGTGTACTGGCAACCATCCAGAAATGTTTTTGACAAAGGTA
AAGCACCTAGAGGTGAGGGCGTGGGCTTTGAAGGTTCATTCACTTTGGAG
GAACTTGAGCTGTAAGGTAACCTGGGAAGTCGAAAAGAACTCGCAGCTGG
GCTTGCCGGTGAGTAAAATGCATAAGATTGCTACTGCTATTGTAATGAAT
CTTGTTTCATTAATAGAAAAATATGAATTTGTGTTCAATGAGGCTAAACA
GTACTACACTAACAGGAGAGTGACCATTGTGGATTTTCAAGGACATTCTC
ATAACTTGAATCGCTATAAGACAATGTGGAACATACCCAGGCAAGTGTCG
TCCACAATGCTTCATCTGTTGAATCATGATGGAATTTCAATACAAGATGG
ATGA
back to top
Protein Sequence

aradu.Aradu.TSK3V.1 sequence

>aradu.Aradu.TSK3V.1
VHPLRDTPSIPKSSKIEFQWGDFCVGADTLKAHGMIWCTGNHPEMFLTKV
KHLEVRAWALKVHSLWRNLSCKVTWEVEKNSQLGLPVSKMHKIATAIVMN
LVSLIEKYEFVFNEAKQYYTNRRVTIVDFQGHSHNLNRYKTMWNIPRQVS
STMLHLLNHDGISIQDG.
back to top