Description
Gene Model Namearadu.Aradu.UED0C
Micro Synteny Viewaradu.Aradu.UED0C
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_5CVLL9
DescriptionProtein phosphatase 2C family protein; IPR001932 (Protein phosphatase 2C (PP2C)-like domain), IPR015655 (Protein phosphatase 2C); GO:0003824 (catalytic activity)
Protein domainsG3DSA:3.60.40.10 PF00481 PTHR13832 SM00331 SM00332 SSF81606
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.UED0C.1

Sequences
Gene Model Namearadu.Aradu.UED0C
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.UED0C.1 sequence

>aradu.Aradu.UED0C.1
ATGACAAGGTTTCAGTTTTACGGAAAAGAATTGAGTGAAACCTCAAAATC
AGCTGTAATAATCAAACAAACAGTGTCAGCAATAAAAAAACAAATCAACA
CGCACAGAGAGAAGAGAAAAAAAGTCAATAAGGGCAACCTACGTATGTAT
TATCCCCACTTCCCCTATTTGCTGCTTGCAAACACCGAACACTTCTTCTT
TCTCTTCACACATACCAAATTCCAGACGTTCTTGGCTTTGTTTCTCTTTG
TCTCTCTCCCCCTCAAAGTTGACGGTAGAATTAGAGACGACCCACTTGCT
CCTCAGATCTTTCAACTTATTTTTGTTGCACAAAGTTTAGATTTTTTTCG
CTCTGTTAGAGGGGTGGTTGGAGGGCATTCTTCAAGTAACTCTGGAAAGG
GCAAGAGCCATCAGTCTACAACCAAGTATGGCTATAGCCTTGTTAAAGGG
AAAGCAAACCACCCGATGGAGGACTATCATGTAGCGAAATTTGTCCAGTT
CAAGGGGCAAGAGCTGGGACTTTTTGCTATATATGATGGACACTTGGGAG
ATAGCGTACCAGCATATTTACAAAAGCATCTTTTTTCAAATATCTTGGAT
GAAAAGGACTTTTGGGAAGATCCGTTCATGTCTATTTCTAAAGCTTATGA
GACAACAGATCAAGCAATTCTTTCTCACAGTCCTGATTTGGGACGAGGAG
GGTCAACTGCTGTGACTGCAATTCTTATAAATAGTCAGAAATTATGGGTA
GCCAATGTTGGAGATTCACGAGCAGTTCTGTCAAGGGGAGGGGTGGCTGT
ACAGATGACTACTGACCATGAACCTAATACTGAGCGGGGCAGCATTGAGA
ACAGAGGTGGCTTTGTCTCAAACATGCCAGGAGATGTTGCAAGGGTGAAT
GGGCAGCTTGCAGTTTCGCGAGCATTTGGAGACAGAAACCTCAAAACACA
TCTGCGATCGGATCCTGACATCCAGTATGCCGATATTAACCCAAATATTG
AGCTTTTGATACTTGCTAGTGATGGTCTATGGAAGGTAATGGGAAACCAA
GAGGCTGTAGATATTGCAAAAAGGATAAAGGATCCACAAAGGGCAGCCCA
ACAACTAGCCACCGAGGCATTGAACAGAGACAGTAAAGATGACATTTCAT
GCATTGTAGTTCGTTTCAAGGGATGAAATAAGGAAAAAAAAACCTACTTG
GGTTTTGGGTACATAATATGGGGGTGCAGTTCCATACCTACTTATATATA
TCATTTTGGTATTTTGTGGAGAATAGCTTTTGCTCCTTCCCTTCTTGATA
TGTAAAATTGAAGTTATTGGATTTTAGGTGGTGCCTTTTAGTATTTCTTG
ATTTCTTGGCTGTGTAGATTCCATACCATAATTTTTCTTTTGTAATATGC
TTTATGACCTGGAGTAGCAGTGTGAAGATGAGCATAGTTATACCCTCGAC
ATTTGTTTTATGATATACTTCAAATGACACTAGCTTGAGTTGCTTCAGCT
GCAATTCAAGTGAGTATACCAATGTTTGAGATTTGTTTCAATTCCCTTTT
TATCCCCTTTCTACAGGCTATAAATGTTAATTATGAATGAAAGCTTAAG
back to top
Protein Sequence

aradu.Aradu.UED0C.1 sequence

>aradu.Aradu.UED0C.1
MTRFQFYGKELSETSKSAVIIKQTVSAIKKQINTHREKRKKVNKGNLRMY
YPHFPYLLLANTEHFFFLFTHTKFQTFLALFLFVSLPLKVDGRIRDDPLA
PQIFQLIFVAQSLDFFRSVRGVVGGHSSSNSGKGKSHQSTTKYGYSLVKG
KANHPMEDYHVAKFVQFKGQELGLFAIYDGHLGDSVPAYLQKHLFSNILD
EKDFWEDPFMSISKAYETTDQAILSHSPDLGRGGSTAVTAILINSQKLWV
ANVGDSRAVLSRGGVAVQMTTDHEPNTERGSIENRGGFVSNMPGDVARVN
GQLAVSRAFGDRNLKTHLRSDPDIQYADINPNIELLILASDGLWKVMGNQ
EAVDIAKRIKDPQRAAQQLATEALNRDSKDDISCIVVRFKG.
back to top
Expression

Gene expression for aradu.Aradu.UED0C has been determined by its associated transcript, Adur32394_comp0_c0_seq2 in the transcript assemblies from Clevenger et al. 2016. Visualization of expression is provided by the eFP browser (Winter et al. 2007). Click the image to explore gene expression data for peanut.