Description
Gene Model Namearadu.Aradu.UK4HJ
Micro Synteny Viewaradu.Aradu.UK4HJ
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_0VBD3W
DescriptionUnknown protein
Protein domains
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.UK4HJ.1

Sequences
Gene Model Namearadu.Aradu.UK4HJ
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.UK4HJ.1 sequence

>aradu.Aradu.UK4HJ.1
CAGCCCATTCATAAGCTAATTTAATGTTCTCCCCTATTTATACTTAGTAA
GTTAAGGTGTCTACCGCACTGCTTTCTTTTATTTTTTCTTCCTATACAAA
GTCTCTATCTCTTTTTCACAAAAATATATTTCAACAAGCTATTTTCAATT
ATAAGATGACTTTTAAGATTGCTCTTTTGATTCTTGGAATTTTAACCGTG
ATTGTTCTAATTCCTTCGGAGGTTCTAGCTCGGGACTTACCAAAAACAGA
ATACACCCCAGAAACAGTTTATAAAATAGAAGAAACACGTCAAATTGCTG
GACCAACTGGGTTAGGAAGAGATGTCAATGACTTGGATGGTGGAAAATAC
AACATTGATCAATGTAAACGTCTTTGTTGTGCTGTAATAGGATTCTGTTT
TTGTTGCTAATGGCATACAAGTGAAAGATGTGAATTTGTTACATCTGTCT
ATGTTAAATCTTATAACTGCCATATGAGAATTAATAAAGGAATAAAATGT
ATACCATTGGTAGAATAATAATCAATAGCTATGTACGTAGCTTGCAAAGA
TTATGTAACTGGACCTATTTGGTTGATGTGGTAATTAAGGTTTTCGAAAT
TGCATTTTCTTTCATAAACAGGGCTTCTCTCTATGTTTTGTATTTTATTT
TTAACTTTTCAAATTTATTTGATTCATTCCCCTAATGAAGAATTATAATC
CAAGCAATATAGTCTACAA
back to top
Protein Sequence

aradu.Aradu.UK4HJ.1 sequence

>aradu.Aradu.UK4HJ.1
MTFKIALLILGILTVIVLIPSEVLARDLPKTEYTPETVYKIEETRQIAGP
TGLGRDVNDLDGGKYNIDQCKRLCCAVIGFCFCC.
back to top
Expression

Gene expression for aradu.Aradu.UK4HJ has been determined by its associated transcript, Adur50342_comp0_c0_seq1 in the transcript assemblies from Clevenger et al. 2016. Visualization of expression is provided by the eFP browser (Winter et al. 2007). Click the image to explore gene expression data for peanut.