Description
Gene Model Namearadu.Aradu.V8Q19
Micro Synteny Viewaradu.Aradu.V8Q19
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_034KHF
Descriptionreplication protein A 1A; IPR012340 (Nucleic acid-binding, OB-fold)
Protein domainsG3DSA:2.40.50.140 PF02721 PF08646 PTHR23273 SSF50249
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.V8Q19.1

Sequences
Gene Model Namearadu.Aradu.V8Q19
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.V8Q19.1 sequence

>aradu.Aradu.V8Q19.1
ATTTGGTTATTCAACTCCACTACCCTGCATTTCCCTCCTCAATTTGATTT
GAATTCAAAAAGGTGAGATTGTATCCTGGATTTTTTCTATAAAAGGATGG
TTGGTGAAGCACATTGAATGCACAAACATTCTGATTTGTTGTGATTGTTC
GTAACCTGAAATTAATTCAGATTTAAAGTGTTTACATTTACATATATTTC
ATCAAGTCTCTTTATCTCCTTTCTTTTTACTGCAATGCCTCCACCATTTG
ATATGATTTCTAAGATGCATCCTCCTAGAGAGGCTTTGAGGCTGAAAGTT
AGGGTTCTAAGGCTTTGGGTTGTACCCTCTTTTGGTAACCATGAGGTTCC
TAACTCAATGGAGATGATTCTCCTTGATGAACATTGTGGAAAAATTCAAG
CTACTGTCAAGAAACCACTCCTTAATAGGTTTAGGGATCATATAGTTGAA
GGACAAGTTTATAGAATGGCATATTTTAGTGTTGTGTCAAATCATGGTAG
TTATAGAGCAACTTCCCATGAATTCAAATTGGTTTTCCTTCACCGAACCA
CTGTTGTAGCTGTTGATGAAGATGTTATCCCTAAGACTTGTTTCAACATG
TTTCCTTTTTCTGAGCTGCTGAACATGACCCAAGATTATGATTTTTTAGT
TGATGTCATTGGACTTTTAACTTCAGTTGGAGAAGAGAAAGAATATGCAA
GAGAGGGAAAAATTGTGAAAATGATTGCATTGGAATTAACTTCAAAAGAT
CTTACAGTGAGATGTGCATTGTTTGGGGATTATGTTAATCAAGTAAATCA
TTTCCTTGCCTCTGGGTATGTGGAGCAGCCTGTTGTAGTTATTCAACTTG
CAAAAGTCAAGTTCTTTCGGGGTCAAGTAGGTCTTCAAAATGTGATGTAT
GCCACTCAAATGTTATTTAATCTTGATATTCCTGAAGTTGTTGAATTTAG
GCAGAGTATGATTGAGCAAGGTGGCAGTGGTACCCAGCCACTGTTTATTG
CAAATGAGGGTAAGGTTCTCTCCTTGGAAGATGACTTCATGCGTCTAACT
AGAAAGTGCACTATTGAAGAGCTTCAAGATAACAATCAGGAGGGTTCTTT
TATCATTTTTGGTGCAATCCAAGGTATTGTTGAGGATGGAGGTTGGTGGT
ATTCTGCTTGTGTGTGTGGAAAGGGTATCTATCCTCAAAATGGTGCCTAT
TACTGTGATTTTTGTTTGAAGCACATCACTAATGTTACTCCAAGATTTAA
AATTAAAGTGACAGTTGAAGATCATACTGGGGAGGGTATTTTCCTTCTCT
TTGATCGTGAGGCTTCCTATTTGCTTAAGAAATCATGTGCTGACTTGTTT
ACTGAGGAGCATGACTTACACAAATCTGTTCCTGCTGGAAAAGCTGATGT
TGGTATTAAGAAGGAGTCTTCTGATAGTTTTATCAAAACTGAGAAAGATG
CTGGTGATTGTGCTGGGATGTTGTGTAAATCCCCAGTTCTTATAGATTTT
TTGGCTGAAAAACAGCCTGTTATTTCTGTGGGGACTGAATTTGTTGGCTT
AATTGATGGTGAGCATGGAAAGGAAGAGAAAACTCCCAGCAATGATACTC
TTAGTGATGATCTTTCTGTTGAAATCGATATATTGCTTAGCTCAACGGAA
AAAGAAACTCAGGAGCTGTTGTCCCATGTTCTTGAAGCACCTTCCCAAAA
TGGAGAGAAGCTTACCCATGAAAATCATGTTGTCACCTCCAAGAGTAAGA
GAAATTTGAATCCTCAGTTTGAAGAGGTTGCTGTTGATGCAGATGGGCGT
GGGTTGAAGGTTGCTAAGGTTAATGGAGTTTGATTGAAGGTGTGGAATTG
AGCTGATGTGTCTAGGTGTAGGTGTCTTATATAGTTTATCTATAAGTATT
TAGGAAGGCTTGTGGTTCCAAATAGATGGACATGTAATCATGCTGGCTTG
ATGGTATTTTGATTTGACTTTTTTGGATTGTGTCCAACAAATAGCATTGT
TAGATATAGGGGTTTTGCTTTTGTGATTGCTCGTGTAATGTGCCAAGTAT
GTCTATTCTGAACTCCTCCTTTTTGTAATAGTGACTTTGCTAGGGATTGG
ACACATTTTCAATGTTGATGACTCTTTAGGTTACATACTATAATATGTAG
CCAGATGTTGGAATCCTTCTTATCA
back to top
Protein Sequence

aradu.Aradu.V8Q19.1 sequence

>aradu.Aradu.V8Q19.1
MPPPFDMISKMHPPREALRLKVRVLRLWVVPSFGNHEVPNSMEMILLDEH
CGKIQATVKKPLLNRFRDHIVEGQVYRMAYFSVVSNHGSYRATSHEFKLV
FLHRTTVVAVDEDVIPKTCFNMFPFSELLNMTQDYDFLVDVIGLLTSVGE
EKEYAREGKIVKMIALELTSKDLTVRCALFGDYVNQVNHFLASGYVEQPV
VVIQLAKVKFFRGQVGLQNVMYATQMLFNLDIPEVVEFRQSMIEQGGSGT
QPLFIANEGKVLSLEDDFMRLTRKCTIEELQDNNQEGSFIIFGAIQGIVE
DGGWWYSACVCGKGIYPQNGAYYCDFCLKHITNVTPRFKIKVTVEDHTGE
GIFLLFDREASYLLKKSCADLFTEEHDLHKSVPAGKADVGIKKESSDSFI
KTEKDAGDCAGMLCKSPVLIDFLAEKQPVISVGTEFVGLIDGEHGKEEKT
PSNDTLSDDLSVEIDILLSSTEKETQELLSHVLEAPSQNGEKLTHENHVV
TSKSKRNLNPQFEEVAVDADGRGLKVAKVNGV.
back to top
Expression

Gene expression for aradu.Aradu.V8Q19 has been determined by its associated transcript, Adur9244_comp1_c0_seq2 in the transcript assemblies from Clevenger et al. 2016. Visualization of expression is provided by the eFP browser (Winter et al. 2007). Click the image to explore gene expression data for peanut.