Description
Gene Model Namearadu.Aradu.VG38U
Micro Synteny Viewaradu.Aradu.VG38U
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_9H2VGN
Descriptionscarecrow-like protein 15-like [Glycine max]; IPR005202 (Transcription factor GRAS)
Protein domainsPF03514 PTHR31636 PTHR31636:SF1
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.VG38U.1

Sequences
Gene Model Namearadu.Aradu.VG38U
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.VG38U.1 sequence

>aradu.Aradu.VG38U.1
ATGAGAGTTAACAATAACACGACATCAAACCCGAAACCCGTAGAAAGCAC
AATCGGCCTCGAGCCCACATCGGTGCTGGACCTGTGTAGAAGTCCCACCC
CTGAGAAGGCAGTGGCTGCGCTGGTGGCTACTGCACCCAACACACAGCAA
GAGTGTCTTGACCAGCTGGAGGACCATGTGCTTCACAATCTTGATTGGGA
CTCCATCATGAAGGATCTTGGATTCCATGAAGACTCCAACCCACCCTTGT
TCAAGACCACCCTCCCTAATGTCCCTGACTTCTCTCCTTCCTTCGACCCA
CACTCCGAATTTCCAGACATCCAAACCATGTCCTACAACTACGCCAACGC
CACTGCCACCCTCGACCACCTCCTCCATGACACCTCCAATAATTCTGCCG
CCACCGGCTTCGATTTCATAGAAGAGCTCATCCGTGCTGCCGATTGCTTC
GACACCAACCACCTCCACGTCGCTCACGTCATATTGGAGCGACTCAATCA
ACGCCTCCGATCCCCTGCGGGTGCAAAGCCTCTCCAACGCGCCGCCTTCT
ACTTCAAGGAAGCTCTCCAGGGCCTCCTCTCCGGTTCCAATCGCACTCCG
CGTTTCTCCTCCCTCGTTGAGATCGTCCACTGCGTCAGAACATTCAAGGC
CTTCTCTGGAATCTCGCCGATCCCTATGTTCTCCATCTTCACCACCAACC
AGGCGCTCCTTGAGGCTTTTCATGGCTCCTCCTTCATGCACGTCCTTGAT
TTTGATATCGGATTAGGGATCCAGTATGCTTCGCTCATGAAGGAGATTGC
AGAAAAGGCGGATTCCTTGAAACACGGATCGCCGCTTCTGCGCATCACCG
CCGTGGTTCCCGAAGAGTACGCCGTCGAGAGCAAACTGATTCGGGAGAAT
CTCAGCCAGTTCGCGCACGAGCTCAGGATCCGCGTCCAGGTCGAGTTTGT
GCCCCTCTGCAACTTCGAGACGCTGTCTTTTAAGGCGGTGAAGTTCGTCG
ATGGCGAGAAAACCGCCGTTCTTCTCTCGCCGGCGATATTCCGACGGCTC
GGTTCCGCTGGGAGCACCGCGGCCTTCCTGGCGGACGTTCGGAGGGTTTC
GCCGAGCGTGGTGGTGTTCGTGGACGGGGAGGGGTGGACGGAAGCTGCGG
CAGCGGCGTCGTTCCGGCGCGGCGTGGTGAGCAGCCTAGAGTTCTACTCG
ATGATGCTGGAGTCGCTGGACGCGTCGATGGTTGCGGGAGGGGAGTGGGT
GAGGAGGATCGAGATGCTTCTGCTGCGCCCGAAGATACTAGCGGCGGTGG
AGGGAGCGGGGCGGAGGGTTCCGCCGTGGAGAGAGGCTTTCTATGGTGCC
GGAATGAGGCCGGTGCAGTTAAGCCAGTTCGCAGATTTTCAGGCGGAGTG
CTTGCTGGCTAAGGTGCAAATCAGGGGCTTCCACGTGGCAAAACGCCAAG
CTGAGCTTGTGCTCTTCTGGCACGAGAGGGCCATGGTTGCCACTGGCTCT
TGTTATGTTAATGAACTTTGCTGGTTGTCAAAATTCGAAGTAGTGTCCTT
TCTATCTCTTTATGCCTTATGGTATGGTATGGGGTATTTTGCTGCAAAAG
TGAGAAATCAAAGCGGTATGAAAATATGTTCTGAGAACCAAACTGGCTTT
GTTGTTTGA
back to top
Protein Sequence

aradu.Aradu.VG38U.1 sequence

>aradu.Aradu.VG38U.1
MRVNNNTTSNPKPVESTIGLEPTSVLDLCRSPTPEKAVAALVATAPNTQQ
ECLDQLEDHVLHNLDWDSIMKDLGFHEDSNPPLFKTTLPNVPDFSPSFDP
HSEFPDIQTMSYNYANATATLDHLLHDTSNNSAATGFDFIEELIRAADCF
DTNHLHVAHVILERLNQRLRSPAGAKPLQRAAFYFKEALQGLLSGSNRTP
RFSSLVEIVHCVRTFKAFSGISPIPMFSIFTTNQALLEAFHGSSFMHVLD
FDIGLGIQYASLMKEIAEKADSLKHGSPLLRITAVVPEEYAVESKLIREN
LSQFAHELRIRVQVEFVPLCNFETLSFKAVKFVDGEKTAVLLSPAIFRRL
GSAGSTAAFLADVRRVSPSVVVFVDGEGWTEAAAAASFRRGVVSSLEFYS
MMLESLDASMVAGGEWVRRIEMLLLRPKILAAVEGAGRRVPPWREAFYGA
GMRPVQLSQFADFQAECLLAKVQIRGFHVAKRQAELVLFWHERAMVATGS
CYVNELCWLSKFEVVSFLSLYALWYGMGYFAAKVRNQSGMKICSENQTGF
VV.
back to top