Description
Gene Model Namearadu.Aradu.W0IT8
Micro Synteny Viewaradu.Aradu.W0IT8
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_LTF1X6
DescriptionMACPF domain protein; IPR020864 (Membrane attack complex component/perforin (MACPF) domain)
Protein domainsPF01823 PTHR32413 PTHR32413:SF0 SM00457
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.W0IT8.1

Sequences
Gene Model Namearadu.Aradu.W0IT8
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.W0IT8.1 sequence

>aradu.Aradu.W0IT8.1
TTTGAACCTCACAAAACGAGATTATGGTAAATAAATAAATAAATATTTTT
GTTGTTTGTATTTTGCCTTATTGTACTTACCAACCCAGTGTGTGAATGGG
GTCCCATGTTTCCTTGTTTCCGTAGCAACCGGAAAGAAATGGAATTAAAA
AAAAAACTTAGAAAACAGAATGACCAAACAGGAATTCAAACTCTCCAATT
AACCTAAGGAATCACAGTCAACCCCAAGAAAAATAAATGATGGCACAAAC
GATACAACCTAGAAAGTTAAAAAATAAGTGGCTGTGTCAATTCCATTTTA
CACTATAAATGAATGAGTTGATCAATTTCATTGAAAAAGGGAATAGAAGG
AAGGGAGAGAGAGAGAGATATGATGGGAAAAGAGGAGATAGTGGAGGAAG
CATTCAGAAGCTTAGGAAAAGGGTTTGACTTGACCTCAGATTTCAGACTC
AAGTTCTGCAAAGGCGAAGAGCGTATGGTTGTTCTGAACGAAACGGAGAG
AAGAGATGTCAGGGTGCCTGGTTTCGGAACCATTAAGGATGTCTCTGTTG
ACATCAAATGGGACAAAGGTGACCGCACTCGCTACCAGTTCGACATCCTT
ACCTTCACCCAGATGTCGGAGCTGTTCAACCAGAAGAGCTCAATACATGG
GAAAATTCCGTCAGGGTATTTCAACAGAGTGTTTGGATTTGATGAAGCTT
CGTGGGCAAGTGATGCAGCCAACACAAAGAATTTGGGTCTTGATGGATAT
TTCATAATTCTCTTCAATGTTCATATTGATCGATACCCGCTTCAACTATC
CAAACAAGTCATTCAACATCTTCCTTCTTCCTGGGATCCTCCTGCACTTG
CAAGATTCATTGAGAAATATGGGACACACATCCTGGTGGGGCTGAGCATT
GGTGGCAAAGATTTGGTGCTTGTGAAGCAAGACGTGTCTTCCAATTTGGG
GCCATCAGATCTGAGGAAGCACTTGGATGACCTTGGAGATCAGTTATTCA
CTGGCACTTGCAATTTCCTTCCCAAAACCAAAGATCACAAGAACAAGGCA
CCACAGGCTTTTGATGTGTTTGGTCCCAAAGTTGTTGCCTTCAATAGCTC
CACATGGGTTTGTGCAAAGGATGGAATAACAGTGATATGTTCAAAGAGAG
GAGGAGACACACAAGTGAGCAACCATTGTGAGTGGCTTCTCACAGTTCCA
GAGAAGCCAGATGCAGTTCATTTCAACTTCATTCCCATCACTTCTCTTCT
CAAAGGTGCTCCTGGCAGAGGCTTCCTCTCACACGCTATCAACCTCTACC
TCAGATATAAACCTCCTATGTCAGATTTGCCATACTTTCTTGACTTCCAA
GCACACAAACTTTGGGCTCCCATTCACAATGATCTGCCTTTGGGTCCACT
CACAAACAGAACCAATCCTTCACCTTCTCTCACCTTCAACTTGATGGGTC
CCAAGCTTTATGTCAACACAGCTAAGATTACAGTGGGTAAGAGACCAATC
ACAGGGATGCGTTTGTTTCTTGAGGGCATCAAGTGCAACAGATTAGCCAT
ACACCTGCAACACCTGTTAAACACTCCAATAATGTTTGATGGGAAAATAG
AGGACACAACAATATGGTCAGAAGAAGTCAACGATGACCGTTTCTATGAA
GCAGTCAACAGCAAGAAATTCTCTCATGTGTGCACAGCACCAGTGAAATA
CAACACTAGATGGAGAACTGAAAATGAGGACGTGGCATTCATTGTCACTG
GGGCACAACTTCATGTGAAGAAACATGATTCAGTAAGGAATGTACTTCAT
CTTAGGCTACTGTTCTCTAAGGTGTCTAATTCAGTTGTTGTGAAATCAAA
TTGGACACAAGGGTCTTCAGGGTTGTCCCAGAAATCTGGGATATTCTCAG
CAATAAGCACATCAATTATTTCTGGAAGTAACAAAGAACATAAAAAACCA
GCATCAGTGGTTGTGGATTCAAGTGTGTTTCCAACAGGGCCTCCAGTGCC
AGTGCAAACACACAAGCTACTGAAATTTGTTGAATTGTCACAGTTATGTA
AAGGGCCACAAGATAGCCCTGGCCATTGGTTGGTCACTGGAGCAAGATTG
GTGTTGGATAAGGGTAAAATACGTTTATGGGTTAAGTTTTCCTTGTTAAA
CACTGGTGAATGAAACAACATAAAAGGAAGGAAATTTTTTCAAACAATTA
TGTTTATATCATAGAATAGTTTATAGGTTCAATCATTAGAATAGTTACTC
CATGGTCCATGCCATGTACGCTTCATTAGATTCGTACTCTC
back to top
Protein Sequence

aradu.Aradu.W0IT8.1 sequence

>aradu.Aradu.W0IT8.1
MMGKEEIVEEAFRSLGKGFDLTSDFRLKFCKGEERMVVLNETERRDVRVP
GFGTIKDVSVDIKWDKGDRTRYQFDILTFTQMSELFNQKSSIHGKIPSGY
FNRVFGFDEASWASDAANTKNLGLDGYFIILFNVHIDRYPLQLSKQVIQH
LPSSWDPPALARFIEKYGTHILVGLSIGGKDLVLVKQDVSSNLGPSDLRK
HLDDLGDQLFTGTCNFLPKTKDHKNKAPQAFDVFGPKVVAFNSSTWVCAK
DGITVICSKRGGDTQVSNHCEWLLTVPEKPDAVHFNFIPITSLLKGAPGR
GFLSHAINLYLRYKPPMSDLPYFLDFQAHKLWAPIHNDLPLGPLTNRTNP
SPSLTFNLMGPKLYVNTAKITVGKRPITGMRLFLEGIKCNRLAIHLQHLL
NTPIMFDGKIEDTTIWSEEVNDDRFYEAVNSKKFSHVCTAPVKYNTRWRT
ENEDVAFIVTGAQLHVKKHDSVRNVLHLRLLFSKVSNSVVVKSNWTQGSS
GLSQKSGIFSAISTSIISGSNKEHKKPASVVVDSSVFPTGPPVPVQTHKL
LKFVELSQLCKGPQDSPGHWLVTGARLVLDKGKIRLWVKFSLLNTGE.
back to top