Description
Gene Model Namearadu.Aradu.XL4I2
Micro Synteny Viewaradu.Aradu.XL4I2
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_2L5PMF
DescriptionRAN GTPase activating protein 2; IPR003590 (Leucine-rich repeat, ribonuclease inhibitor subtype), IPR025265 (WPP domain)
Protein domainsG3DSA:3.80.10.10 PF13516 PF13943 PTHR24106 SM00368 SSF52047
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.XL4I2.1

Sequences
Gene Model Namearadu.Aradu.XL4I2
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.XL4I2.1 sequence

>aradu.Aradu.XL4I2.1
ATGGAGCTGAATTCGCCGCAGAGACCGTTTTCAATCAAATTGTGGCCACC
TAGTCAGAACACTAGACAGACACTTGTGGAGAGGATGGCCAACAATCTGA
CAACGAAATCTGTTTTCACACAAAGGTACGGAAATTTGGACAAGGAAGAA
GCTCAAGAGAATGCAAAAAGAATTGAGGATGTGGCTTTTGCAACAGCAAA
TCAACACTACGAGCAGGAGCCCGATGGTGATGGAGGTTCTGCAGTCCAGC
TTTATGCCAAAGAATGTAGTAAGCTCCTCTTAGAAGTTCTCAAAAGAGGG
CCGGGTCTAAATGGTAAAGAAGAAGTGGTAGCATCTGATAATACCTCTGC
ACCTGCTGAAGCTGTATTTGATATATCCAAAGGCAAAAGGGCCTTTATTG
AACCTGATGAGGCCGAGGAACTACTAAGGCCGTTAAAGGAGCCAGAAAAT
TCTTTCACCAAAATATGCTTCAGCAACTGGAGTTTTGGACTAGGAGCAGC
ACAAGTTGCCCAGCCCATTCTCAGTTCCATCAAGCACCAGTTGAAAGATG
TAGATCTATCGGATTTTATTGCTGGAAGACCAGAAGCTGAAGCTCTTGAT
GTCATGAATATATTCTCAACTGCACTAGAGGGTGCTGCCCTAAGGTCTTT
AAACCTCTCTGACAACGCTTTAGGGGAGAAAGGTGTTAGAGCATTTGGAG
CACTATTGAAGTCGCAAAACCACTTGGAGGAGCTTTATCTAATGAATGAT
GGAATCTCAGAGGAAGCTGCTCAAGCAATTTGTGAATTGATTCCTTCTAC
TGAGAAGCTCAAAGTTCTTCATTTCCATAATAATATGACCGGAGATGAAG
GGGCATTAGCTATTGCTGAGATTGTGAAGCGTTCTCCTTCCTTGGAGGAT
TTTCGTTGTTCCTCCACAAGGATAGGTGCTGAAGGTGGAGTTGCCCTGTC
CAATGCTTTAGGAAATTGTATCCATCTGAGGAAGCTTGATTTGCGAGATA
ACATGTTTGGAGTAGAGGGTGGTATTTCTTTGAGTAAAGCTCTTACAAGG
CATGCAGAATTGAGAGAGATATACCTGAGCTACCTCAACTTAGAAGATGA
TGGTGCAATTGCTATAATCAATGCTCTTAAGGAATCAGCACCTTACCTTG
AAGTTCTGGAGATGAGTGGAAATGACATTACAGCCGAAGCTGTTCCTGCA
ATAGGAGCATGCCTAGAAGCAAAGATCTTCCTTGCCAGGTTGAACCTCTC
CGAGAATGAACTCGAGGACGAAGGTGCCATCCAGGTAAGCAAGGCTTTAG
AAGGCCACTTTCACTTAAAGGAAGTTGATCTGAGTAGCAACAAAATATCG
AGGGTGGGGGCTCAACAGTTGGCTCTGACTCTGGTGCAAAAGGCAAATTT
CCAACTTCTATTCATCAATGGAAACATCATTTCCACTGAAGGGGTTGAAG
AGTTGAAGGACATATTCAAAACTTCTCTGGACATGCTTGGTCCATTAGAT
GAAAATGACCCTGATGGAATAGACAGCGATGAAGAATCTGATGAAGAGGG
TGGTGATATTGAACTGGAATCGAAAATGAAGAGTCTTGCAGTTAATTAA
back to top
Protein Sequence

aradu.Aradu.XL4I2.1 sequence

>aradu.Aradu.XL4I2.1
MELNSPQRPFSIKLWPPSQNTRQTLVERMANNLTTKSVFTQRYGNLDKEE
AQENAKRIEDVAFATANQHYEQEPDGDGGSAVQLYAKECSKLLLEVLKRG
PGLNGKEEVVASDNTSAPAEAVFDISKGKRAFIEPDEAEELLRPLKEPEN
SFTKICFSNWSFGLGAAQVAQPILSSIKHQLKDVDLSDFIAGRPEAEALD
VMNIFSTALEGAALRSLNLSDNALGEKGVRAFGALLKSQNHLEELYLMND
GISEEAAQAICELIPSTEKLKVLHFHNNMTGDEGALAIAEIVKRSPSLED
FRCSSTRIGAEGGVALSNALGNCIHLRKLDLRDNMFGVEGGISLSKALTR
HAELREIYLSYLNLEDDGAIAIINALKESAPYLEVLEMSGNDITAEAVPA
IGACLEAKIFLARLNLSENELEDEGAIQVSKALEGHFHLKEVDLSSNKIS
RVGAQQLALTLVQKANFQLLFINGNIISTEGVEELKDIFKTSLDMLGPLD
ENDPDGIDSDEESDEEGGDIELESKMKSLAVN.
back to top