Description
Gene Model Namearadu.Aradu.YEB9X
Micro Synteny Viewaradu.Aradu.YEB9X
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_7TPGY7
DescriptionMitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein
Protein domains
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.YEB9X.1

Sequences
Gene Model Namearadu.Aradu.YEB9X
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.YEB9X.1 sequence

>aradu.Aradu.YEB9X.1
TTGATCTTTACGTCTAAATACTCTTTTAAAAACTCGGGTGAACGGACTGG
CGAAGAAGCAGGTGTCACAACAAAAGGTGACATCGACTGACAAAGAGGAA
GGAAGTTGTTTTCACGAGTCACGACTGGCAGTGGCGACACCGATCAGAAT
GCGGGCAGATTTGACGATGAGAAATTGAGAATTTAGAGCTCCTTCCACTT
CGATTCGGTTACCTAATTTAACTAATTTCTCCGTACACAACTCTGTTTCC
ATTTTACGGCGTTTACCGCCATGGAAGCCACCGACGACGCAGAATCCCCC
GCACTGATTGCCTCCGCAAAGTTAGCGAGAACTGTTAACTGGGGTACAAC
AACTGTTATTGGAATATTTGCTGGCATGTTATACGGCGGTAGTAAGGAGG
CAGCTGCTTCTATTAGCAAGGACGCAGAAGTGACTTTGAAGCTTGGAAGT
ACAGAAGACAAACGTGAGCAATATCGTTTGATGAAAGATGCTATGGAGAA
ATGGTTCATTAGGGTTACACGGGGCTCAATAGTTGGAGGAGTATGCCTTG
GAATGTTCACAGCTACATTTTATAGCTTACAAAATCTACTTGCAGAGCAG
CAAGGTGTGCATGATGTTTTTAATATTGTTGGTGCTGGTTCAGCTACTGC
TTCAGCTTTTGGTTTAACATGTAAGAAATAATACTCTGCCACTAGACTCT
TTATAACATGGACTGAATCACAAAAACAATTCATTTTTCATTCATTTCAT
TGTATTAA
back to top
Protein Sequence

aradu.Aradu.YEB9X.1 sequence

>aradu.Aradu.YEB9X.1
MEATDDAESPALIASAKLARTVNWGTTTVIGIFAGMLYGGSKEAAASISK
DAEVTLKLGSTEDKREQYRLMKDAMEKWFIRVTRGSIVGGVCLGMFTATF
YSLQNLLAEQQGVHDVFNIVGAGSATASAFGLTCKK.
back to top