Description
Gene Model Namearadu.Aradu.Z5G5W
Micro Synteny Viewaradu.Aradu.Z5G5W
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_TGHRG2
DescriptionMBOAT (membrane bound O-acyl transferase) family protein
Protein domainsPF13813 PTHR31595 PTHR31595:SF0
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.Z5G5W.1

Sequences
Gene Model Namearadu.Aradu.Z5G5W
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.Z5G5W.1 sequence

>aradu.Aradu.Z5G5W.1
ATGAAATTAGTAAATCTTGCCTACCTACCACATCCACTTGGTGGTTATAG
TTTCTCCAATTGGAAGCAGGTACCATTTAATGGTTTCCCTCCTAATAGGG
GACTTTTCCATTTTGGTCAATTCCCATATATGATATTCAGTATTCACATG
CACATAATTTCAGACATTAGGAACATATTACTCACTATGCAAAATATGTT
GGGCCCAAAATGCAAGGAATTGGAAGGAGAAATCAAGAGCTTAATGAAGG
TATGGTTTTCAATCATAGCCTCACTATGTTACTGTTATTTCATATCATCA
AATATACCAAAAGGAAAGTTAAGGCTTCTCAGCCTCACACCAGTTTTGTG
TCTCTTCACCTTCCTTCCACTTCAACTCTCCTATGTCCTCCCAACAGGTA
TCACTGCCTTCTTGATTACATGGCTCACAAGCTTCAAGCTCATCCTTTTC
ACCTTTGACTTGGGCCCACTCTCTTCAAACCCACCAAAGTCTCTTCCTTT
CTTCCTCTCCTTTGCTTGCCTACCCCTTAGAGGGATCACCCAAAACCAAA
ATCAACCATACCCATCTAACCAAACTCACCAAAATCACTCAAAAGTCAAT
GTAAGAAAGGAAAAGCTTCATTTCATTATTTTCCCTATCAAGGCCTTGCT
TTTTGGGGTATTATTGATGGGCCTTAATGACCACAAACAAAAGATTGACC
ACACAGTTATTATTGGCCTATATTGCATCCTTGTTTTTCTATTGGTAGAT
ATTGTTGTGGGACTTTGTAACATTGTGGCCAATGCTGCACTTGGGATTGA
GCTAGAACTACCCTCTAATGAGCCTTACTTGTCCACTTCATTGCAAGAAT
TCTGGGGAAGGAGGTGGAACCTCATTGTAACATATCTTCTTAGACACACT
ATATACATTCCTGTGAGAACTGCACTGTCCAGGACGGTATTGGGCCCCCA
ATGGGCCTCAGTGCCCGGAGTCATGGCGTCTTTCGTGGTGTCCGGGATAA
TGCACGAGCTGTTGTTCTATTACGTCACACGTGCCGCTCCCACGTGGGAG
GTCACGTGCTTCTTTGTCTTGCATGGGGTGTGTGTGGTTGTGGAGTTGTG
TGTGATGAAGTGGTTGGGACACAAAGGGATGCTACATTGGGCTATTTCAG
GGCCCGTCACGGTGGTGTTTGTGGTGGCCACCGCCGCATGTCTCTTCTTT
CCGCCGCTGTTGCGTGATGGGGCTGATGAGAGAGCCTTGGAGGAGTTCAG
GAATTTAGTTGATTGTATAAAGGAAACATTTTAA
back to top
Protein Sequence

aradu.Aradu.Z5G5W.1 sequence

>aradu.Aradu.Z5G5W.1
MKLVNLAYLPHPLGGYSFSNWKQVPFNGFPPNRGLFHFGQFPYMIFSIHM
HIISDIRNILLTMQNMLGPKCKELEGEIKSLMKVWFSIIASLCYCYFISS
NIPKGKLRLLSLTPVLCLFTFLPLQLSYVLPTGITAFLITWLTSFKLILF
TFDLGPLSSNPPKSLPFFLSFACLPLRGITQNQNQPYPSNQTHQNHSKVN
VRKEKLHFIIFPIKALLFGVLLMGLNDHKQKIDHTVIIGLYCILVFLLVD
IVVGLCNIVANAALGIELELPSNEPYLSTSLQEFWGRRWNLIVTYLLRHT
IYIPVRTALSRTVLGPQWASVPGVMASFVVSGIMHELLFYYVTRAAPTWE
VTCFFVLHGVCVVVELCVMKWLGHKGMLHWAISGPVTVVFVVATAACLFF
PPLLRDGADERALEEFRNLVDCIKETF.
back to top