Description
Gene Model Namearadu.Aradu.ZQ977
Micro Synteny Viewaradu.Aradu.ZQ977
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Familylegfed_v1_0.L_3N20WJ
Descriptionunknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 17 plant structures; EXPRESSED DURING: 10 growth stages
Protein domains
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.ZQ977.1

Sequences
Gene Model Namearadu.Aradu.ZQ977
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.ZQ977.1 sequence

>aradu.Aradu.ZQ977.1
ATTGATTCTCACTAAATCTTAAAGATTTAAAGAAAATAAAATATTTTATT
TTATTTTTATTTAAACTCAAATCAAAAGTAATAATAACTTATTTTATTTA
GTATTTACAACAAAAAGATCCTTCCAAATCAAAACCACCATGATGAAATG
CTACATTAGACCCTATATCATTGTCTAGTGTGCTCTAATTTTGAGGCACA
CATGAGAATTATGGATAAGCAGTTGCATAGGTTGTTTGTGTTGATGAATG
TTCTTATTGTGTTCAGCTTCTTTGATCTCTCAACAGTAGCAGAGAGTGAG
AATCATGTTTCTGCAGTAGGAGATCCAGGAATGAAGAGAAATGAACTGAG
AGTAGCATTTGAAGCTTGGAATTTCTGCAATGAGGTTGGGGAAGAAGCTC
CTCACATGGGTAGCCCAAGAGCTGCTGATTGCTTTGATCTTTCAAATTCT
CTCAAACACAAGGTAACAAAAGATGATAACAAACTTGGGGTTGGAAAACC
AATTCCTGGTATAAAATCAGATTCAATTGATATAAACAACACAGACCTTT
ATGCTGTTGAAAAAGAACTGTATCTTGGTTCATTGTGTGAAGTTGAAGAC
ACACCAAAGCCTTGGCAATTTTGGATGATAATGCTGAAGAATGGAAACTA
TGACACAAGCTCTGGTTTGTGTCCCATGGATGGGAGAAAGGTTCCCCCTT
TTGGTAGTCATGGGAGGTTTCCTTGCTTTGGGAAAGGCTGCATGAACCAA
CCCATCTTGTGTCATCAACAAACAAGGATAAAAAATGGAACAATGCATGG
AATGTTTCATGGTACATATGATTTGGATTCTGATTGCAAGGGTGAGAAAG
ATGGCTTGTCTTACTATGAAGTTGTGTGGGAGAAGAAAGTTGATGATTCT
GCGAGTTGGATCTTCAAACATAAGCTCAGAACTTCAAAGAAATATCCATG
GTTGATGCTGTACCTTAGAGCTGATGCAACCACAGGATTCTCTGGAGGGT
ATCATTATGACACAAGAGGAATGCTTAAAATTCTTCCAGAATCACCAAAT
TTTAAGGTCAAGTTGAGCTTAGATATAAAAAAGGGTGGGGGTCCCAAGAG
CCAGTTCTACCTGTTGGACATAGGTAGCTGCTGGAAGAACAATGGTGCTC
CTTGTGATGGAGATGTTCTAACTGATGTAACCAGATACAGTGAGATGATC
ATAAATCCTGAAACACCAGCCTGGTGCAGCCCAAAGGGTTTGGAAAATTG
CCCTCCATTTCATATCACACCAGACAACAAGAAAATCCATAGAAATGACA
CTGAAAACTTCCCCTATTCTGCTTATCACTTTTACTGTGCTCCTGGTAAT
GCTCAACAATTAGAGCAACCTGTTAAAACTTGTGATCCTTATAGCAATCC
TCAAGCACAAGAGATTGTTCAGTTGTTGCCTCACCCTATATGGGGTGATT
ATGGCTATCCAACAAAAAAAGGAGATGGTTGGGTTGGAGATCCAAGAACT
TGGGAACTTGATGTTGGTGGTCTTTCAAGTAGACTATACTTCTATCAGGA
TCCTGGAACAGTTCCTGCTAAAAGAATATGGACTTCTGTGGATACTGGAA
CTGAGATATTTGTCAGCACAAAAGATGAAGTAGCAGAGTGGACTCTTAGT
GATTTTGATGTTATTCTTACAGAACCAAAGTCATGAATCAA
back to top
Protein Sequence

aradu.Aradu.ZQ977.1 sequence

>aradu.Aradu.ZQ977.1
EAHMRIMDKQLHRLFVLMNVLIVFSFFDLSTVAESENHVSAVGDPGMKRN
ELRVAFEAWNFCNEVGEEAPHMGSPRAADCFDLSNSLKHKVTKDDNKLGV
GKPIPGIKSDSIDINNTDLYAVEKELYLGSLCEVEDTPKPWQFWMIMLKN
GNYDTSSGLCPMDGRKVPPFGSHGRFPCFGKGCMNQPILCHQQTRIKNGT
MHGMFHGTYDLDSDCKGEKDGLSYYEVVWEKKVDDSASWIFKHKLRTSKK
YPWLMLYLRADATTGFSGGYHYDTRGMLKILPESPNFKVKLSLDIKKGGG
PKSQFYLLDIGSCWKNNGAPCDGDVLTDVTRYSEMIINPETPAWCSPKGL
ENCPPFHITPDNKKIHRNDTENFPYSAYHFYCAPGNAQQLEQPVKTCDPY
SNPQAQEIVQLLPHPIWGDYGYPTKKGDGWVGDPRTWELDVGGLSSRLYF
YQDPGTVPAKRIWTSVDTGTEIFVSTKDEVAEWTLSDFDVILTEPKS.
back to top
Expression

Gene expression for aradu.Aradu.ZQ977 has been determined by its associated transcript, Adur22297_comp0_c0_seq1 in the transcript assemblies from Clevenger et al. 2016. Visualization of expression is provided by the eFP browser (Winter et al. 2007). Click the image to explore gene expression data for peanut.