Description
Gene Model Namearadu.Aradu.ZT0IM
Micro Synteny Viewaradu.Aradu.ZT0IM
OrganismArachis duranensis (Arachis duranensis)
Assembly versionaradu.V14167.gnm1
Gene Model Buildaradu.V14167.gnm1.ann1
Gene Family not assigned to a gene family
DescriptionUnknown protein
Protein domains
mRNA and protein identifiers
(also see Sequences tab)
aradu.Aradu.ZT0IM.1

Sequences
Gene Model Namearadu.Aradu.ZT0IM
This gene model has 1 associated mRNAs
mRNA Sequence

aradu.Aradu.ZT0IM.1 sequence

>aradu.Aradu.ZT0IM.1
ATGAACTGGCCGGTTATTGGTCGGTCGAACCGAACCGGAATCCGGCCGCC
TCCACTTCCTCGTTCCTCCACCTCCACCTTCTCAGTTCTCAACTCCAGCC
TCCCAAAGAATAGAACACCACCCAGTCACCCACGACTCCAGGAGGCCCTC
AACGCACCCACCGCCGTCGCACTCACGCCCTCAACTCCAGCCTTCAGCAC
GGTCACGCCCTCACCAGCTTCCCGCCGTCAGCTCCCTCATTTCCAGGTAT
GGAAGAAAGCATCAACCAAGACCTACCTGAGATGTTGGATTTCAGCAACT
GGCATTTTCTGTGGGGATATTTCTATCAGCGCAGCTGCCAAAAAAGCATA
TCGCTTGGCTGTTACAGTGGTAGCTACTGTTGGAGGTAAAGGTGTCATCA
AAGCATCAAGAATTTTCTGCCTCAGCAGAGGAACTCTTGTTCCATATTTC
CCTTTGCCAGTAACTGCATACCGTATGCAAGTGGCCCATTCAGGAACTGA
TTCAACAGGTGCTAGAATGATATTCTTCAACTGAGGCATGAGCCAGCTTT
CCCACTCTCCCAATAGACCATCAACATCAGAGTGTAACACACCCGCCAAT
ACTTCAGCAGCTACACATTGTTTAGACCTCTCCTTGGTAGTTGTAAACTC
ATCTACAGCGCCTTTTAGCGCCACTACAATTGGCATGACGCATTCTTGTA
CAAGCCGCTTGAAAATACGTGCAAAACTTGAGTAGAATGTATCACTCCCA
AAAAATGAGATCCAACTTGGAGTGCGTGGCCATGAAGCCGAGAATTCAAA
GTAGAAGCGGGTTATAGATTTGTCAGCCAAGCTTTGGAAACTGGAATCTC
CATGACCTCCTCTAGAAGCACTTTCAGAATCACTTTAATTTGAATGA
back to top
Protein Sequence

aradu.Aradu.ZT0IM.1 sequence

>aradu.Aradu.ZT0IM.1
MNWPVIGRSNRTGIRPPPLPRSSTSTFSVLNSSLPKNRTPPSHPRLQEAL
NAPTAVALTPSTPAFSTVTPSPASRRQLPHFQVWKKASTKTYLRCWISAT
GIFCGDISISAAAKKAYRLAVTVVATVGGKGVIKASRIFCLSRGTLVPYF
PLPVTAYRMQVAHSGTDSTGARMIFFN.
back to top